published on Monday, May 4, 2026 by fortinetdev
published on Monday, May 4, 2026 by fortinetdev
Service level agreement (SLA).
This resource is a sub resource for variable
slaof resourcefortimanager.WantempSystemSdwanHealthcheck. Conflict and overwrite may occur if use both of them.
Create WantempSystemSdwanHealthcheckSla Resource
Resources are created with functions called constructors. To learn more about declaring and configuring resources, see Resources.
Constructor syntax
new WantempSystemSdwanHealthcheckSla(name: string, args: WantempSystemSdwanHealthcheckSlaArgs, opts?: CustomResourceOptions);@overload
def WantempSystemSdwanHealthcheckSla(resource_name: str,
args: WantempSystemSdwanHealthcheckSlaInitArgs,
opts: Optional[ResourceOptions] = None)
@overload
def WantempSystemSdwanHealthcheckSla(resource_name: str,
opts: Optional[ResourceOptions] = None,
health_check: Optional[str] = None,
wanprof: Optional[str] = None,
link_cost_factors: Optional[Sequence[str]] = None,
fosid: Optional[float] = None,
jitter_threshold: Optional[float] = None,
latency_threshold: Optional[float] = None,
adom: Optional[str] = None,
mos_threshold: Optional[str] = None,
packetloss_threshold: Optional[float] = None,
priority_in_sla: Optional[float] = None,
priority_out_sla: Optional[float] = None,
scopetype: Optional[str] = None,
update_if_exist: Optional[bool] = None,
custom_profile_threshold: Optional[float] = None,
wantemp_system_sdwan_healthcheck_sla_id: Optional[str] = None)func NewWantempSystemSdwanHealthcheckSla(ctx *Context, name string, args WantempSystemSdwanHealthcheckSlaArgs, opts ...ResourceOption) (*WantempSystemSdwanHealthcheckSla, error)public WantempSystemSdwanHealthcheckSla(string name, WantempSystemSdwanHealthcheckSlaArgs args, CustomResourceOptions? opts = null)
public WantempSystemSdwanHealthcheckSla(String name, WantempSystemSdwanHealthcheckSlaArgs args)
public WantempSystemSdwanHealthcheckSla(String name, WantempSystemSdwanHealthcheckSlaArgs args, CustomResourceOptions options)
type: fortimanager:WantempSystemSdwanHealthcheckSla
properties: # The arguments to resource properties.
options: # Bag of options to control resource's behavior.
resource "fortimanager_wantempsystemsdwanhealthchecksla" "name" {
# resource properties
}Parameters
- name string
- The unique name of the resource.
- args WantempSystemSdwanHealthcheckSlaArgs
- The arguments to resource properties.
- opts CustomResourceOptions
- Bag of options to control resource's behavior.
- resource_name str
- The unique name of the resource.
- args WantempSystemSdwanHealthcheckSlaInitArgs
- The arguments to resource properties.
- opts ResourceOptions
- Bag of options to control resource's behavior.
- ctx Context
- Context object for the current deployment.
- name string
- The unique name of the resource.
- args WantempSystemSdwanHealthcheckSlaArgs
- The arguments to resource properties.
- opts ResourceOption
- Bag of options to control resource's behavior.
- name string
- The unique name of the resource.
- args WantempSystemSdwanHealthcheckSlaArgs
- The arguments to resource properties.
- opts CustomResourceOptions
- Bag of options to control resource's behavior.
- name String
- The unique name of the resource.
- args WantempSystemSdwanHealthcheckSlaArgs
- The arguments to resource properties.
- options CustomResourceOptions
- Bag of options to control resource's behavior.
Constructor example
The following reference example uses placeholder values for all input properties.
var wantempSystemSdwanHealthcheckSlaResource = new Fortimanager.WantempSystemSdwanHealthcheckSla("wantempSystemSdwanHealthcheckSlaResource", new()
{
HealthCheck = "string",
Wanprof = "string",
LinkCostFactors = new[]
{
"string",
},
Fosid = 0,
JitterThreshold = 0,
LatencyThreshold = 0,
Adom = "string",
MosThreshold = "string",
PacketlossThreshold = 0,
PriorityInSla = 0,
PriorityOutSla = 0,
Scopetype = "string",
UpdateIfExist = false,
CustomProfileThreshold = 0,
WantempSystemSdwanHealthcheckSlaId = "string",
});
example, err := fortimanager.NewWantempSystemSdwanHealthcheckSla(ctx, "wantempSystemSdwanHealthcheckSlaResource", &fortimanager.WantempSystemSdwanHealthcheckSlaArgs{
HealthCheck: pulumi.String("string"),
Wanprof: pulumi.String("string"),
LinkCostFactors: pulumi.StringArray{
pulumi.String("string"),
},
Fosid: pulumi.Float64(0),
JitterThreshold: pulumi.Float64(0),
LatencyThreshold: pulumi.Float64(0),
Adom: pulumi.String("string"),
MosThreshold: pulumi.String("string"),
PacketlossThreshold: pulumi.Float64(0),
PriorityInSla: pulumi.Float64(0),
PriorityOutSla: pulumi.Float64(0),
Scopetype: pulumi.String("string"),
UpdateIfExist: pulumi.Bool(false),
CustomProfileThreshold: pulumi.Float64(0),
WantempSystemSdwanHealthcheckSlaId: pulumi.String("string"),
})
resource "fortimanager_wantempsystemsdwanhealthchecksla" "wantempSystemSdwanHealthcheckSlaResource" {
health_check = "string"
wanprof = "string"
link_cost_factors = ["string"]
fosid = 0
jitter_threshold = 0
latency_threshold = 0
adom = "string"
mos_threshold = "string"
packetloss_threshold = 0
priority_in_sla = 0
priority_out_sla = 0
scopetype = "string"
update_if_exist = false
custom_profile_threshold = 0
wantemp_system_sdwan_healthcheck_sla_id = "string"
}
var wantempSystemSdwanHealthcheckSlaResource = new WantempSystemSdwanHealthcheckSla("wantempSystemSdwanHealthcheckSlaResource", WantempSystemSdwanHealthcheckSlaArgs.builder()
.healthCheck("string")
.wanprof("string")
.linkCostFactors("string")
.fosid(0.0)
.jitterThreshold(0.0)
.latencyThreshold(0.0)
.adom("string")
.mosThreshold("string")
.packetlossThreshold(0.0)
.priorityInSla(0.0)
.priorityOutSla(0.0)
.scopetype("string")
.updateIfExist(false)
.customProfileThreshold(0.0)
.wantempSystemSdwanHealthcheckSlaId("string")
.build());
wantemp_system_sdwan_healthcheck_sla_resource = fortimanager.WantempSystemSdwanHealthcheckSla("wantempSystemSdwanHealthcheckSlaResource",
health_check="string",
wanprof="string",
link_cost_factors=["string"],
fosid=float(0),
jitter_threshold=float(0),
latency_threshold=float(0),
adom="string",
mos_threshold="string",
packetloss_threshold=float(0),
priority_in_sla=float(0),
priority_out_sla=float(0),
scopetype="string",
update_if_exist=False,
custom_profile_threshold=float(0),
wantemp_system_sdwan_healthcheck_sla_id="string")
const wantempSystemSdwanHealthcheckSlaResource = new fortimanager.WantempSystemSdwanHealthcheckSla("wantempSystemSdwanHealthcheckSlaResource", {
healthCheck: "string",
wanprof: "string",
linkCostFactors: ["string"],
fosid: 0,
jitterThreshold: 0,
latencyThreshold: 0,
adom: "string",
mosThreshold: "string",
packetlossThreshold: 0,
priorityInSla: 0,
priorityOutSla: 0,
scopetype: "string",
updateIfExist: false,
customProfileThreshold: 0,
wantempSystemSdwanHealthcheckSlaId: "string",
});
type: fortimanager:WantempSystemSdwanHealthcheckSla
properties:
adom: string
customProfileThreshold: 0
fosid: 0
healthCheck: string
jitterThreshold: 0
latencyThreshold: 0
linkCostFactors:
- string
mosThreshold: string
packetlossThreshold: 0
priorityInSla: 0
priorityOutSla: 0
scopetype: string
updateIfExist: false
wanprof: string
wantempSystemSdwanHealthcheckSlaId: string
WantempSystemSdwanHealthcheckSla Resource Properties
To learn more about resource properties and how to use them, see Inputs and Outputs in the Architecture and Concepts docs.
Inputs
In Python, inputs that are objects can be passed either as argument classes or as dictionary literals.
The WantempSystemSdwanHealthcheckSla resource accepts the following input properties:
- Health
Check string - Health Check.
- Wanprof string
- Wanprof.
- Adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - Custom
Profile doubleThreshold - Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
- Fosid double
- SLA ID.
- Jitter
Threshold double - Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- Latency
Threshold double - Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- Link
Cost List<string>Factors - Criteria on which to base link selection. Valid values:
latency,jitter,packet-loss. - Mos
Threshold string - Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
- Packetloss
Threshold double - Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
- Priority
In doubleSla - Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
- Priority
Out doubleSla - Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
- Scopetype string
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - Update
If boolExist - Wantemp
System stringSdwan Healthcheck Sla Id - an identifier for the resource with format {{fosid}}.
- Health
Check string - Health Check.
- Wanprof string
- Wanprof.
- Adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - Custom
Profile float64Threshold - Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
- Fosid float64
- SLA ID.
- Jitter
Threshold float64 - Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- Latency
Threshold float64 - Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- Link
Cost []stringFactors - Criteria on which to base link selection. Valid values:
latency,jitter,packet-loss. - Mos
Threshold string - Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
- Packetloss
Threshold float64 - Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
- Priority
In float64Sla - Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
- Priority
Out float64Sla - Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
- Scopetype string
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - Update
If boolExist - Wantemp
System stringSdwan Healthcheck Sla Id - an identifier for the resource with format {{fosid}}.
- health_
check string - Health Check.
- wanprof string
- Wanprof.
- adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - custom_
profile_ numberthreshold - Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
- fosid number
- SLA ID.
- jitter_
threshold number - Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- latency_
threshold number - Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- link_
cost_ list(string)factors - Criteria on which to base link selection. Valid values:
latency,jitter,packet-loss. - mos_
threshold string - Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
- packetloss_
threshold number - Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
- priority_
in_ numbersla - Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
- priority_
out_ numbersla - Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
- scopetype string
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - update_
if_ boolexist - wantemp_
system_ stringsdwan_ healthcheck_ sla_ id - an identifier for the resource with format {{fosid}}.
- health
Check String - Health Check.
- wanprof String
- Wanprof.
- adom String
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - custom
Profile DoubleThreshold - Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
- fosid Double
- SLA ID.
- jitter
Threshold Double - Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- latency
Threshold Double - Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- link
Cost List<String>Factors - Criteria on which to base link selection. Valid values:
latency,jitter,packet-loss. - mos
Threshold String - Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
- packetloss
Threshold Double - Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
- priority
In DoubleSla - Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
- priority
Out DoubleSla - Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
- scopetype String
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - update
If BooleanExist - wantemp
System StringSdwan Healthcheck Sla Id - an identifier for the resource with format {{fosid}}.
- health
Check string - Health Check.
- wanprof string
- Wanprof.
- adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - custom
Profile numberThreshold - Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
- fosid number
- SLA ID.
- jitter
Threshold number - Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- latency
Threshold number - Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- link
Cost string[]Factors - Criteria on which to base link selection. Valid values:
latency,jitter,packet-loss. - mos
Threshold string - Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
- packetloss
Threshold number - Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
- priority
In numberSla - Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
- priority
Out numberSla - Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
- scopetype string
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - update
If booleanExist - wantemp
System stringSdwan Healthcheck Sla Id - an identifier for the resource with format {{fosid}}.
- health_
check str - Health Check.
- wanprof str
- Wanprof.
- adom str
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - custom_
profile_ floatthreshold - Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
- fosid float
- SLA ID.
- jitter_
threshold float - Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- latency_
threshold float - Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- link_
cost_ Sequence[str]factors - Criteria on which to base link selection. Valid values:
latency,jitter,packet-loss. - mos_
threshold str - Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
- packetloss_
threshold float - Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
- priority_
in_ floatsla - Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
- priority_
out_ floatsla - Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
- scopetype str
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - update_
if_ boolexist - wantemp_
system_ strsdwan_ healthcheck_ sla_ id - an identifier for the resource with format {{fosid}}.
- health
Check String - Health Check.
- wanprof String
- Wanprof.
- adom String
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - custom
Profile NumberThreshold - Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
- fosid Number
- SLA ID.
- jitter
Threshold Number - Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- latency
Threshold Number - Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- link
Cost List<String>Factors - Criteria on which to base link selection. Valid values:
latency,jitter,packet-loss. - mos
Threshold String - Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
- packetloss
Threshold Number - Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
- priority
In NumberSla - Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
- priority
Out NumberSla - Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
- scopetype String
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - update
If BooleanExist - wantemp
System StringSdwan Healthcheck Sla Id - an identifier for the resource with format {{fosid}}.
Outputs
All input properties are implicitly available as output properties. Additionally, the WantempSystemSdwanHealthcheckSla resource produces the following output properties:
- Id string
- The provider-assigned unique ID for this managed resource.
- Id string
- The provider-assigned unique ID for this managed resource.
- id string
- The provider-assigned unique ID for this managed resource.
- id String
- The provider-assigned unique ID for this managed resource.
- id string
- The provider-assigned unique ID for this managed resource.
- id str
- The provider-assigned unique ID for this managed resource.
- id String
- The provider-assigned unique ID for this managed resource.
Look up Existing WantempSystemSdwanHealthcheckSla Resource
Get an existing WantempSystemSdwanHealthcheckSla resource’s state with the given name, ID, and optional extra properties used to qualify the lookup.
public static get(name: string, id: Input<ID>, state?: WantempSystemSdwanHealthcheckSlaState, opts?: CustomResourceOptions): WantempSystemSdwanHealthcheckSla@staticmethod
def get(resource_name: str,
id: str,
opts: Optional[ResourceOptions] = None,
adom: Optional[str] = None,
custom_profile_threshold: Optional[float] = None,
fosid: Optional[float] = None,
health_check: Optional[str] = None,
jitter_threshold: Optional[float] = None,
latency_threshold: Optional[float] = None,
link_cost_factors: Optional[Sequence[str]] = None,
mos_threshold: Optional[str] = None,
packetloss_threshold: Optional[float] = None,
priority_in_sla: Optional[float] = None,
priority_out_sla: Optional[float] = None,
scopetype: Optional[str] = None,
update_if_exist: Optional[bool] = None,
wanprof: Optional[str] = None,
wantemp_system_sdwan_healthcheck_sla_id: Optional[str] = None) -> WantempSystemSdwanHealthcheckSlafunc GetWantempSystemSdwanHealthcheckSla(ctx *Context, name string, id IDInput, state *WantempSystemSdwanHealthcheckSlaState, opts ...ResourceOption) (*WantempSystemSdwanHealthcheckSla, error)public static WantempSystemSdwanHealthcheckSla Get(string name, Input<string> id, WantempSystemSdwanHealthcheckSlaState? state, CustomResourceOptions? opts = null)public static WantempSystemSdwanHealthcheckSla get(String name, Output<String> id, WantempSystemSdwanHealthcheckSlaState state, CustomResourceOptions options)resources: _: type: fortimanager:WantempSystemSdwanHealthcheckSla get: id: ${id}import {
to = fortimanager_wantempsystemsdwanhealthchecksla.example
id = "${id}"
}
- name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- state
- Any extra arguments used during the lookup.
- opts
- A bag of options that control this resource's behavior.
- resource_name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- state
- Any extra arguments used during the lookup.
- opts
- A bag of options that control this resource's behavior.
- name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- state
- Any extra arguments used during the lookup.
- opts
- A bag of options that control this resource's behavior.
- name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- state
- Any extra arguments used during the lookup.
- opts
- A bag of options that control this resource's behavior.
- Adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - Custom
Profile doubleThreshold - Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
- Fosid double
- SLA ID.
- Health
Check string - Health Check.
- Jitter
Threshold double - Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- Latency
Threshold double - Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- Link
Cost List<string>Factors - Criteria on which to base link selection. Valid values:
latency,jitter,packet-loss. - Mos
Threshold string - Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
- Packetloss
Threshold double - Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
- Priority
In doubleSla - Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
- Priority
Out doubleSla - Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
- Scopetype string
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - Update
If boolExist - Wanprof string
- Wanprof.
- Wantemp
System stringSdwan Healthcheck Sla Id - an identifier for the resource with format {{fosid}}.
- Adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - Custom
Profile float64Threshold - Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
- Fosid float64
- SLA ID.
- Health
Check string - Health Check.
- Jitter
Threshold float64 - Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- Latency
Threshold float64 - Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- Link
Cost []stringFactors - Criteria on which to base link selection. Valid values:
latency,jitter,packet-loss. - Mos
Threshold string - Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
- Packetloss
Threshold float64 - Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
- Priority
In float64Sla - Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
- Priority
Out float64Sla - Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
- Scopetype string
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - Update
If boolExist - Wanprof string
- Wanprof.
- Wantemp
System stringSdwan Healthcheck Sla Id - an identifier for the resource with format {{fosid}}.
- adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - custom_
profile_ numberthreshold - Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
- fosid number
- SLA ID.
- health_
check string - Health Check.
- jitter_
threshold number - Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- latency_
threshold number - Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- link_
cost_ list(string)factors - Criteria on which to base link selection. Valid values:
latency,jitter,packet-loss. - mos_
threshold string - Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
- packetloss_
threshold number - Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
- priority_
in_ numbersla - Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
- priority_
out_ numbersla - Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
- scopetype string
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - update_
if_ boolexist - wanprof string
- Wanprof.
- wantemp_
system_ stringsdwan_ healthcheck_ sla_ id - an identifier for the resource with format {{fosid}}.
- adom String
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - custom
Profile DoubleThreshold - Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
- fosid Double
- SLA ID.
- health
Check String - Health Check.
- jitter
Threshold Double - Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- latency
Threshold Double - Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- link
Cost List<String>Factors - Criteria on which to base link selection. Valid values:
latency,jitter,packet-loss. - mos
Threshold String - Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
- packetloss
Threshold Double - Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
- priority
In DoubleSla - Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
- priority
Out DoubleSla - Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
- scopetype String
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - update
If BooleanExist - wanprof String
- Wanprof.
- wantemp
System StringSdwan Healthcheck Sla Id - an identifier for the resource with format {{fosid}}.
- adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - custom
Profile numberThreshold - Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
- fosid number
- SLA ID.
- health
Check string - Health Check.
- jitter
Threshold number - Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- latency
Threshold number - Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- link
Cost string[]Factors - Criteria on which to base link selection. Valid values:
latency,jitter,packet-loss. - mos
Threshold string - Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
- packetloss
Threshold number - Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
- priority
In numberSla - Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
- priority
Out numberSla - Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
- scopetype string
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - update
If booleanExist - wanprof string
- Wanprof.
- wantemp
System stringSdwan Healthcheck Sla Id - an identifier for the resource with format {{fosid}}.
- adom str
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - custom_
profile_ floatthreshold - Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
- fosid float
- SLA ID.
- health_
check str - Health Check.
- jitter_
threshold float - Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- latency_
threshold float - Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- link_
cost_ Sequence[str]factors - Criteria on which to base link selection. Valid values:
latency,jitter,packet-loss. - mos_
threshold str - Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
- packetloss_
threshold float - Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
- priority_
in_ floatsla - Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
- priority_
out_ floatsla - Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
- scopetype str
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - update_
if_ boolexist - wanprof str
- Wanprof.
- wantemp_
system_ strsdwan_ healthcheck_ sla_ id - an identifier for the resource with format {{fosid}}.
- adom String
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - custom
Profile NumberThreshold - Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
- fosid Number
- SLA ID.
- health
Check String - Health Check.
- jitter
Threshold Number - Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- latency
Threshold Number - Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- link
Cost List<String>Factors - Criteria on which to base link selection. Valid values:
latency,jitter,packet-loss. - mos
Threshold String - Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
- packetloss
Threshold Number - Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
- priority
In NumberSla - Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
- priority
Out NumberSla - Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
- scopetype String
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - update
If BooleanExist - wanprof String
- Wanprof.
- wantemp
System StringSdwan Healthcheck Sla Id - an identifier for the resource with format {{fosid}}.
Import
Wantemp SystemSdwanHealthCheckSla can be imported using any of these accepted formats:
Set import_options = [“wanprof=YOUR_VALUE”, “health_check=YOUR_VALUE”] in the provider section.
$ export “FORTIMANAGER_IMPORT_TABLE”=“true”
$ pulumi import fortimanager:index/wantempSystemSdwanHealthcheckSla:WantempSystemSdwanHealthcheckSla labelname {{fosid}}
$ unset “FORTIMANAGER_IMPORT_TABLE”
-> Hint: The scopetype and adom for import will directly inherit the scopetype and adom configuration of the provider.
To learn more about importing existing cloud resources, see Importing resources.
Package Details
- Repository
- fortimanager fortinetdev/terraform-provider-fortimanager
- License
- Notes
- This Pulumi package is based on the
fortimanagerTerraform Provider.
published on Monday, May 4, 2026 by fortinetdev
